EBAG9 Fragment MS Protein Standard

Receptor-binding cancer antigen expressed on SiSo cells

EBAG9 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human EBAG9 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

EBAG9

Cancer-associated surface antigen RCAS1, Estrogen receptor-binding fragment-associated gene 9 protein

O00559

RGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI