PSMD14 Fragment MS Protein Standard

26S proteasome non-ATPase regulatory subunit 14

PSMD14 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PSMD14 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PSMD14

26S proteasome regulatory subunit RPN11, 26S proteasome-associated PAD1 homolog 1

O00487

AVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDA