SMLR1 Fragment MS Protein Standard

Small leucine-rich protein 1

SMLR1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SMLR1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SMLR1

Endothelial tyrosine kinase, Tunica interna endothelial cell kinase, Tyrosine kinase with Ig and EGF homology domains-2, Tyrosine-protein kinase receptor TEK, Tyrosine-protein kinase receptor TIE-2, p140 TEK

H3BR10

FRIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKW