FTCDNL1 Fragment MS Protein Standard

Formiminotransferase N-terminal subdomain-containing protein

FTCDNL1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FTCDNL1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FTCDNL1

Formiminotransferase-cyclodeaminase N-terminal-like protein

E5RQL4

EAGRKYIVENIAKAALLDKNGKKHPQVSVLNIFSDQDYKRSVITIATSVDKLGLAEDLVLH