TMEM200C Fragment MS Protein Standard

Transmembrane protein 200C

TMEM200C Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TMEM200C protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TMEM200C

Transmembrane protein TTMA, Two transmembrane domain-containing family member A

A6NKL6

GYWPKATGTNREGGKQLPPAGSSHRVPTTANSSSSGSKNRSRSHPRAPGGVNSSSA