MOXD2P Fragment MS Protein Standard

Putative DBH-like monooxygenase protein 2

MOXD2P Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MOXD2P protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MOXD2P

DBH-like monooxygenase protein 2 pseudogene

A6NHM9

LGVPLQSNRLGPTSRLRYSRFLDPSNVIFLRWDFDLEAEIISFELQVRTAGWVGFGVTNRYTNVGSDLVVGGVLPNGNVYFSDQH