PABPN1L Fragment MS Protein Standard

Embryonic polyadenylate-binding protein 2

PABPN1L Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PABPN1L protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PABPN1L

Embryonic poly(A)-binding protein type II, Poly(A)-binding protein nuclear-like 1

A6NDY0

MWPFPSRSLFPPPTQAWLQTVSSDPEAQGWGAWNETKEILGPEGGEGKEEKEE