CCDC88B Fragment MS Protein Standard

Coiled-coil domain-containing protein 88B

CCDC88B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CCDC88B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CCDC88B

Brain leucine zipper domain-containing protein, Hook-related protein 3

A6NC98

GLRQEGPEHKPGPSEPSSVQLEEQEGPNQGLDLATGQAEAREHDQRLEGTVRDPAWQKPQQKSEGALEVQVWEGPIPGESLASGVAEQEALREEVAQLRRKAEALGDELEAQARKLEAQNTEAARLSKELAQ