CCL15 Full-Length MS Protein Standard

chemokine (C-C motif) ligand 15

CCL15 Full-Length MS Protein Standard (NP_116740), Labeled with [U- ¹³C₆, ¹⁵N₄]-L-Arginine and [U- ¹³C₆, ¹⁵N₂]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. This gene is located in a cluster of similar genes in the same region of chromosome 17. These genes encode CC cytokines, which are secreted proteins characterized by two adjacent cysteines. The product of this gene is chemotactic for T cells and monocytes, and acts through C-C chemokine receptor type 1 (CCR1). The proprotein is further processed into numerous smaller functional peptides. Naturally-occurring readthrough transcripts occur from this gene into the downstream gene, CCL14 (chemokine (C-C motif) ligand 14).

CCL15

HCC-2; HMRP-2B; Lkn-1; LKN1; MIP-1d; MIP-5; NCC-3; NCC3; SCYA15; SCYL3; SY15

NM_032964

17q11.2

[U- ¹³C₆, ¹⁵N₄]-L-Arg and [U- ¹³C₆, ¹⁵N₂]-L-Lys

> 80% as determined by SDS-PAGE and Coomassie blue staining

Human HEK293 cells

12.7 kDa

RC212975

>RC212975 representing NM_032964
MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSY
FETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI