VENTX Full-Length MS Protein Standard

Product Information
Protein Name
VENT homeobox
Symbol
VENTX
Synonyms
HPX42B; NA88A; VENTX2
Accession
NM_014468
Description
VENTX Full-Length MS Protein Standard (NP_055283), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. This gene encodes a member of the Vent family of homeodomain proteins. The encoded protein may function as a transcriptional repressor and be involved in mesodermal patterning and hemopoietic stem cell maintenance. Multiple pseudogenes exist for this gene. A transcribed pseudogene located on chromosome X may lead to antigen production in certain melanomas.
Cytogenetic
10q26.3
Amino Acid Labeled
[U- 13C6, 15N4]-L-Arg and [U- 13C6, 15N2]-L-Lys
Chemical Purity
> 80% as determined by SDS-PAGE and Coomassie blue staining
Expression Host
Human HEK293 cells
Predicted MW
27.4 kDa
Expression True or False Clone
RC211761
Protein Sequence
>RC211761 representing NM_014468
MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSPGSLPGPGQTSGAREPPQAVSIKEAAGSS
NLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQ
NRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQ
EALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2021 Creative Proteomics. All rights reserved.
2
Inquiry Basket