AIP Full-Length MS Protein Standard

Product Information
Protein Name
aryl hydrocarbon receptor interacting protein
Symbol
AIP
Synonyms
ARA9; FKBP16; FKBP37; SMTPHN; XAP-2; XAP2
Accession
NM_003977
Description
AIP Full-Length MS Protein Standard (NP_003968), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus.
Cytogenetic
11q13.3
Amino Acid Labeled
[U- 13C6, 15N4]-L-Arg and [U- 13C6, 15N2]-L-Lys
Chemical Purity
> 80% as determined by SDS-PAGE and Coomassie blue staining
Expression Host
Human HEK293 cells
Predicted MW
37.5 kDa
Expression True or False Clone
RC211157
Protein Sequence
>RC211157 representing NM_003977
MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKL
PVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDA
LQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLK
NLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWN
AQEAQADFAKVLELDPALAPVVSRELRALEARIRQKDEEDKARFRGIFSH

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

Related Products
Copyright © 2021 Creative Proteomics. All rights reserved.
2
Inquiry Basket