YARS2 Full-Length MS Protein Standard

Product Information
Protein Name
tyrosyl-tRNA synthetase 2, mitochondrial
Symbol
YARS2
Synonyms
CGI-04; MLASA2; MT-TYRRS; TYRRS
Accession
NM_001040436
Description
YARS2 Full-Length MS Protein Standard (NP_001035526), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. This gene encodes a mitochondrial protein that catalyzes the attachment of tyrosine to tRNA(Tyr). Mutations in this gene are associated with myopathy with lactic acidosis and sideroblastic anemia type 2 (MLASA2).
Cytogenetic
12p11.21
Amino Acid Labeled
[U- 13C6, 15N4]-L-Arg and [U- 13C6, 15N2]-L-Lys
Chemical Purity
> 80% as determined by SDS-PAGE and Coomassie blue staining
Expression Host
Human HEK293 cells
Predicted MW
53 kDa
Expression True or False Clone
RC204828
Protein Sequence
>RC204828 representing NM_001040436
MAAPILRSFSWGRWSGTLNLSVLLPLGLRKAHSGAQGLLAAQKARGLFKDFFPETGTKIELPELFDRGTA
SFPQTIYCGFDPTADSLHVGHLLALLGLFHLQRAGHNVIALVGGATARLGDPSGRTKEREALETERVRAN
ARALRLGLEALAANHQQLFTDGRSWGSFTVLDNSAWYQKQHLVDFLAAVGGHFRMGTLLSRQSVQLRLKS
PEGMSLAEFFYQVLQAYDFYYLFQRYGCRVQLGGSDQLGNIMSGYEFINKLTGEDVFGITVPLITSTTGA
KLGKSAGNAVWLNRDKTSPFELYQFFVRQPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLA
AEVTKLVHGREGLDSAKRCTQALYHSSIDALEVMSDQELKELFKEAPFSEFFLDPGTSVLDTCRKANAIP
DGPRGYRMITEGGVSINHQQVTNPESVLIVGQHILKNGLSLLKIGKRNFYIIKWLQL

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2021 Creative Proteomics. All rights reserved.
2
Inquiry Basket