DBNDD1 Full-Length MS Protein Standard

Product Information
Protein Name
dysbindin (dystrobrevin binding protein 1) domain containing 1
Symbol
DBNDD1
Synonyms
FLJ12582; MGC3101
Accession
NM_024043
Description
DBNDD1 Full-Length MS Protein Standard (NP_076948), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics.
Cytogenetic
16q24.3
Amino Acid Labeled
[U- 13C6, 15N4]-L-Arg and [U- 13C6, 15N2]-L-Lys
Chemical Purity
> 80% as determined by SDS-PAGE and Coomassie blue staining
Expression Host
Human HEK293 cells
Predicted MW
19.5 kDa
Expression True or False Clone
RC200971
Protein Sequence
>RC200971 representing NM_024043
MGETWKNICSTVRHGWWLRDHRMAGLPIPPEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAP
GLLQVTERRQPLSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSP
SWTRTRAEQSHEKQPLGDPERQATVLDTFLTVERPQED

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2021 Creative Proteomics. All rights reserved.
2
Inquiry Basket