F11R Full-Length MS Protein Standard

Product Information
Protein Name
F11 receptor
Symbol
F11R
Synonyms
JAM, KAT, JAM1, JAMA, JCAM, CD321, JAM-1, JAM-A, PAM-1
Accession
NM_144504
Description
F11R Full-Length MS Protein Standard (NP_653087), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is an important regulator of tight junction assembly in epithelia. In addition, the encoded protein can act as (1) a receptor for reovirus, (2) a ligand for the integrin LFA1, involved in leukocyte transmigration, and (3) a platelet receptor. Multiple 5 alternatively spliced variants, encoding the same protein, have been identified but their biological validity has not been established.
Cytogenetic
1q21.2-q21.3
Amino Acid Labeled
[U- 13C6, 15N4]-L-Arg and [U- 13C6, 15N2]-L-Lys
Chemical Purity
> 80% as determined by SDS-PAGE and Coomassie blue staining
Expression Host
Human HEK293 cells
Predicted MW
29.8 kDa
Expression True or False Clone
RC200004
Protein Sequence
>RC200004 representing NM_144504
MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTT
RLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIP
SSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEY
SCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIY
SQPSARSEGEFKQTSSFLV

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

Related Products
Copyright © 2021 Creative Proteomics. All rights reserved.
2
Inquiry Basket