MS Grade α-Lactalbumin


Product Description:

NameMS Grade α-Lactalbumin
Cat#CPAS100050
AccessionP00711
Molecular Weight14186
Protein Sequence>CPAS100050

EQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDT
QAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNIS
CDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEK
LDQWLCEKL
SourceBovine Milk

Related Products

Online Inquiry

Please submit a detailed description of your project. We will provide you with a customized project plan to meet your research requests. You can also send emails directly to for inquiries.

Stay in contact

  • 45-1 Ramsey Road, Shirley, NY 11967, USA
  • Tel: 1-631-275-3058
  • Fax: 1-631-614-7828
  • Email:
© 2008-2019 Creative Proteomics. All rights reserved.