MS Grade Carbonic Anhydrase


Product Description:

NameMS Grade Carbonic Anhydrase
Cat#CPAS100043
AccessionP00921
Molecular Weight29024
Protein Sequence>CPAS100043

SHHWGYGKHNGPEHWHKDFPIANGERQSPVDIDTKAVV
QDPALKPLALVYGEATSRRMVNNGHSFNVEYDDSQDKA
VLKDGPLTGTYRLVQFHFHWGSSDDQGSEHTVDRKKYA
AELHLVHWNTKYGDFGTAAQQPDGLAVVGVFLKVGDAN
PALQKVLDALDSIKTKGKSTDFPNFDPGSLLPNVLDYW
TYPGSLTTPPLLESVTWIVLKEPISVSSQQMLKFRTLN
FNAEGEPELLMLANWRPAQPLKNRQVRGFPK
Sourcebovine erythrocytes

* For Research Use Only. Not for use in diagnostic procedures.

Related Products

Online Inquiry

Please submit a detailed description of your project. We will provide you with a customized project plan to meet your research requests. You can also send emails directly to for inquiries.

  • Verification Code

Stay in Contact

  • 45-1 Ramsey Road, Shirley, NY 11967, USA
  • Tel: 1-631-275-3058 (USA)
  • Tel: 44-208-144-6005 (Europe)
  • Fax: 1-631-614-7828
  • Email:
© 2008-2021 Creative Proteomics. All rights reserved.