Product Description:

Name	GLP-1 MS Grade peptide
Cat#	CPWHB102714
Synonyms	7-37 Acetate peptide
Description	GLP-1 (7-37) is a truncated and bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. Moreover, it is a potent insulinotropic hormone; and it belongs to the glucagon family. GLP-1 is a potent stimulator of glucose-dependent insulin release. It acts on gastric motility and the suppression of plasma glucagon levels. Consequently, it may be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues. GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.
Chemical Formula	C151H228N40O47
Molecular Weight	3355.74 g/mol
Sequence	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Related Products

• beta-Secretase Inhibitor II MS Grade peptide
• Heparin-Binding MS Grade peptide
• Delta-Sleep Inducing Peptide MS Grade peptide
• [Ser25]-PKC (19-36) Substrate MS Grade peptide
• Z-Tyr-Val-Ala-Asp-CMK MS Grade peptide