Name | GLP-1 MS Grade peptide |
Cat# | CPWHB102714 |
Synonyms | 7-37 Acetate peptide |
Description | GLP-1 (7-37) is a truncated and bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. Moreover, it is a potent insulinotropic hormone; and it belongs to the glucagon family. GLP-1 is a potent stimulator of glucose-dependent insulin release. It acts on gastric motility and the suppression of plasma glucagon levels. Consequently, it may be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues. GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. |
Chemical Formula | C151H228N40O47 |
Molecular Weight | 3355.74 g/mol |
Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
Related Products