Amylin (1-37) MS Grade peptide


Product Description:

NameAmylin (1-37) MS Grade peptide
Cat#CPWHB100708
SynonymsDiabetes Associated (DAP), amide, DAP, Diabetes associated peptide, IAP, IAPP, Insulinoma amyloid peptide, islet amyloid polypeptide
DescriptionAmylin (1-37) MS Grade peptide. The peptide is Unconjugated. This polypeptide is homologous to the Fruit fly protein.
Chemical FormulaInquiry
Molecular WeightInquiry
SequenceSequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2, disulfide bonds: C2=C7.

Related Products

Online Inquiry

Please submit a detailed description of your project. We will provide you with a customized project plan to meet your research requests. You can also send emails directly to for inquiries.

Stay in contact

  • 45-1 Ramsey Road, Shirley, NY 11967, USA
  • Tel: 1-631-275-3058
  • Fax: 1-631-614-7828
  • Email:
© 2008-2019 Creative Proteomics. All rights reserved.