RUVBL1 Fragment MS Protein Standard

Product Information
Protein Name
RuvB-like 1
Description
RUVBL1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RUVBL1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
RUVBL1
Synonyms
49 kDa TATA box-binding protein-interacting protein, 54 kDa erythrocyte cytosolic protein, INO80 complex subunit H, Nuclear matrix protein 238, Pontin 52, TIP49a, TIP60-associated protein 54-alpha
Uniprot ID
Q9Y265
Product Sequence
GPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGG

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket