TRPM5 Fragment MS Protein Standard

Transient receptor potential cation channel subfamily M member 5

TRPM5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TRPM5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TRPM5

Long transient receptor potential channel 5, MLSN1- and TRP-related gene 1 protein

Q9NZQ8

KEAEHKREHLERDLPDPLDQKVVTWETVQKENFLSKMEKRRRDSEGEVLRKTAHRVDFIAKYLGGLREQEKRIKCLESQINYCSVLV