SERPIND1 Fragment MS Protein Standard

Heparin cofactor 2

SERPIND1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SERPIND1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SERPIND1

Heparin cofactor II, Protease inhibitor leuserpin-2, Serpin D1

P05546

EAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNE