Home > Products > MS Protein Standards > MS Grade Hemoglobin, β chain

MS Grade Hemoglobin, β chain

INQUIRY>

Product Description


NameMS Grade Hemoglobin, β chain
Cat#CPAS100059
Accessionβ Chain: P02070
Protein Sequence>CPAS100059
β Chain: AAs (1-145)
MLTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTADAVMNNPKV
KAHGKKVLDSFSNGMKHLDDLKGTFAALSELHCDKLHVDPENFKLLGNVLVVVLARNFG
KEFTPVLQADFQKVVAGVANALAHRYH
SourceBovine

Online Inquiry


Please input "proteomics" as verification code.