Home > Products > MS Protein Standards > MS Grade Hemoglobin, α chain

MS Grade Hemoglobin, α chain

INQUIRY>

Product Description


NameMS Grade Hemoglobin, α chain
Cat#CPAS100058
Accessionα Chain: P01966
Protein Sequence>CPAS100058
α Chain: AAs (2-142)
VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
AKVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFT
PAVHASLDKFLANVSTVLTSKYR
SourceBovine

Online Inquiry


Please input "proteomics" as verification code.