Home > Products > MS Protein Standards > MS Grade Hemoglobin

MS Grade Hemoglobin

INQUIRY>

Product Description


NameMS Grade Hemoglobin
Cat#CPAS100057
Accessionα Chain: P01966, β Chain: P02070
Protein Sequence>CPAS100057

α Chain: AAs (2-142)
VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
AKVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFT
PAVHASLDKFLANVSTVLTSKYR
β Chain: AAs (1-145)
MLTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTADAVMNNPKV
KAHGKKVLDSFSNGMKHLDDLKGTFAALSELHCDKLHVDPENFKLLGNVLVVVLARNFG
KEFTPVLQADFQKVVAGVANALAHRYH
SourceBovine

Online Inquiry


Please input "proteomics" as verification code.