Home > Products > MS Protein Standards > MS Grade α-chymotrypsinogen A

MS Grade α-chymotrypsinogen A

INQUIRY>

Product Description


NameMS Grade α-chymotrypsinogen A
Cat#CPAS100054
AccessionP00766
Molecular Weight25657
Protein Sequence>CPAS100054

CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDK
TGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFD
QGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKL
STAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLT
RYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWG
SSTCSTSTPGVYARVTALVNWVQQTLAAN
SourceBovine

Online Inquiry


Please input "proteomics" as verification code.