Home > Products > MS Protein Standards > MS Grade β-casein

MS Grade β-casein

INQUIRY>

Product Description


NameMS Grade β-casein
Cat#CPAS100053
AccessionP02666
Molecular Weight23981
Protein Sequence>CPAS100053

RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQ
QTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLT
QTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVE
PFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVM
FPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQE
PVLGPVRGPFPIIV
SourceBovine Pancreas

Online Inquiry


Please input "proteomics" as verification code.