Home > Products > MS Protein Standards > MS Grade α-casein

MS Grade α-casein

INQUIRY>

Product Description


NameMS Grade α-casein
Cat#CPAS100052
AccessionP02662
Molecular Weight23616
Protein Sequence>CPAS100052

LVAVALARPKHPIKHQGLPQEVLNENLLRFFVAPFPEV
FGKEKVNELSKDIGSESTEDQAMEDIKQMEAESISSSE
EIVPNSVEQKHIQKEDVPSERYLGYLEQLLRLKKYKVP
QLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYF
YPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIP
NPIGSENSEKTTMPLW
SourceBovine Milk

Online Inquiry


Please input "proteomics" as verification code.