Home > Products > MS Protein Standards > MS Grade Insulin

MS Grade Insulin

INQUIRY>

Product Description


NameMS Grade Insulin
Cat#CPAS100051
AccessionP01308-1
Molecular Weight5808
Protein Sequence>CPAS100051

FVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTSI
CSLYQLENYCN
SourceRecombiant Human

Online Inquiry


Please input "proteomics" as verification code.