Home > Products > MS Protein Standards > MS Grade α-Lactalbumin

MS Grade α-Lactalbumin

INQUIRY>

Product Description


NameMS Grade α-Lactalbumin
Cat#CPAS100050
AccessionP00711
Molecular Weight14186
Protein Sequence>CPAS100050

EQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDT
QAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNIS
CDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEK
LDQWLCEKL
SourceBovine Milk

Online Inquiry


Please input "proteomics" as verification code.