Home > Products > MS Protein Standards > MS Grade Phosphorylase B

MS Grade Phosphorylase B

INQUIRY>

Product Description


NameMS Grade Phosphorylase B
Cat#CPAS100048
AccessionP00489
Molecular Weight97158
Protein Sequence>CPAS100048

SRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFT
LVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYE
KDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQ
LGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGL
AAYGYGIRYEFGIFNQKICGGWQMEEADDWLRYGNPWE
KARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDT
PVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAV
LDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATL
QDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHP
SLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAF
PGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVA
RIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVL
CNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIR
DVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRI
HEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGK
AAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLE
NYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLN
GALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLD
QRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKD
IVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWT
RMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPA
PDEKIP
Sourcerabbit muscle

Online Inquiry


Please input "proteomics" as verification code.