Home > Products > MS Protein Standards > MS Grade Ovalbumin

MS Grade Ovalbumin

INQUIRY>

Product Description


NameMS Grade Ovalbumin
Cat#CPAS100047
AccessionP01012
Molecular Weight42750
Protein Sequence>CPAS100047

GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSAL
AMVYLGAKDSTRTQINKVVRFDKLPGFGDSIEAQCGTS
VNVHSSLRDILNQITKPNDVYSFSLASRLYAEERYPIL
PEYLQCVKELYRGGLEPINFQTAADQARELINSWVESQ
TNGIIRNVLQPSSVDSQTAMVLVNAIVFKGLWEKAFKD
EDTQAMPFRVTEQESKPVQMMYQIGLFRVASMASEKMK
ILELPFASGTMSMLVLLPDEVSGLEQLESIINFEKLTE
WTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMAMGITD
VFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVV
GSAEAGVDAASVSEEFRADHPFLFCIKHIATNAVLFFG
RCVSP
Sourcechicken egg white

Online Inquiry


Please input "proteomics" as verification code.