Home > Products > MS Protein Standards > MS Grade BSA (Bovine Serum Albumin)

MS Grade BSA (Bovine Serum Albumin)

INQUIRY>

Product Description


NameMS Grade BSA (Bovine Serum Albumin)
Cat#CPAS100042
AccessionP02769
Molecular Weight66399
Protein Sequence>CPAS100042

DTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDE
HVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCK
VASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPK
LKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPE
LLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLA
SSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFV
EVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDN
QDTISSKLKECCDKPLLEKSHCIAEVEKDAIPENLPPL
TADFAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAV
SVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLV
DEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVS
TPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLIL
NRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDE
TYVPKAFDEKLFTFHADICTLPDTEKQIKKQTALVELL
KHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVE
GPKLVVSTQTALA
Sourcebovine serum

Online Inquiry


Please input "proteomics" as verification code.