Home > Products > MS Peptide Standards > Amylin (1-37) MS Grade peptide

Amylin (1-37) MS Grade peptide

INQUIRY>

Product Description


NameAmylin (1-37) MS Grade peptide
Cat#CPWHB100708
SynonymsDiabetes Associated (DAP), amide, DAP, Diabetes associated peptide, IAP, IAPP, Insulinoma amyloid peptide, islet amyloid polypeptide
DescriptionAmylin (1-37) MS Grade peptide. The peptide is Unconjugated. This polypeptide is homologous to the Fruit fly protein.
Chemical FormulaInquiry
Molecular WeightInquiry
SequenceSequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2, disulfide bonds: C2=C7.

Online Inquiry


Please input "proteomics" as verification code.